Structure of PDB 7po3 Chain 3

Receptor sequence
>7po33 (length=71) Species: 9606 (Homo sapiens) [Search protein sequence]
KNVLKIRRRKMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIW
LKAGLKEAPEGWQTPKIYLRG
3D structure
PDB7po3 Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
Chain3
Resolution2.92 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3 K128 V130 L131 K132 I133 R134 R136 K137 M138 N139 H140 H141 K142 Y143 R144 K145 L146 K148 R151 R161 R164 K165 K171 R174 R175 Y195 R197 K1 V3 L4 K5 I6 R7 R9 K10 M11 N12 H13 H14 K15 Y16 R17 K18 L19 K21 R24 R34 R37 K38 K44 R47 R48 Y68 R70
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0032543 mitochondrial translation
GO:0045839 negative regulation of mitotic nuclear division
GO:0045862 positive regulation of proteolysis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005759 mitochondrial matrix
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0043231 intracellular membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7po3, PDBe:7po3, PDBj:7po3
PDBsum7po3
PubMed35676484
UniProtQ9NWT8|AKIP_HUMAN Small ribosomal subunit protein mS38 (Gene Name=AURKAIP1)

[Back to BioLiP]