Structure of PDB 7pnw Chain 3

Receptor sequence
>7pnw3 (length=72) Species: 10090 (Mus musculus) [Search protein sequence]
KNVLKIRRRKMNHHKYRKLVKRTRFLRRKVREGRLKKKQIKFEKDLKRIW
LKAGLKEAPENWQTPKIYLKNK
3D structure
PDB7pnw Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
Chain3
Resolution3.09 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3 K129 V131 L132 K133 I134 R135 R136 R137 K138 M139 N140 H141 H142 K143 Y144 R145 K146 L147 K149 R152 R156 R159 R162 K166 K172 I177 Y196 K1 V3 L4 K5 I6 R7 R8 R9 K10 M11 N12 H13 H14 K15 Y16 R17 K18 L19 K21 R24 R28 R31 R34 K38 K44 I49 Y68
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0004842 ubiquitin-protein transferase activity
Biological Process
GO:0016567 protein ubiquitination
GO:0032543 mitochondrial translation
GO:0045862 positive regulation of proteolysis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005680 anaphase-promoting complex
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005759 mitochondrial matrix
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0043231 intracellular membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pnw, PDBe:7pnw, PDBj:7pnw
PDBsum7pnw
PubMed35676484
UniProtQ9DCJ7|AKIP_MOUSE Small ribosomal subunit protein mS38 (Gene Name=Aurkaip1)

[Back to BioLiP]