Structure of PDB 7pnt Chain 3

Receptor sequence
>7pnt3 (length=50) Species: 10090 (Mus musculus) [Search protein sequence]
TRFLRRKVREGRLKKKQIKFEKDLKRIWLKAGLKEAPENWQTPKIYLKNK
3D structure
PDB7pnt Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
Chain3
Resolution3.19 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3 R152 R156 R159 R162 K166 K172 Y196 R2 R6 R9 R12 K16 K22 Y46
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0004842 ubiquitin-protein transferase activity
Biological Process
GO:0016567 protein ubiquitination
GO:0032543 mitochondrial translation
GO:0045862 positive regulation of proteolysis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005680 anaphase-promoting complex
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005759 mitochondrial matrix
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0043231 intracellular membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pnt, PDBe:7pnt, PDBj:7pnt
PDBsum7pnt
PubMed35676484
UniProtQ9DCJ7|AKIP_MOUSE Small ribosomal subunit protein mS38 (Gene Name=Aurkaip1)

[Back to BioLiP]