Structure of PDB 7p7u Chain 3 |
>7p7u3 (length=80) Species: 1351 (Enterococcus faecalis) [Search protein sequence] |
MKQDIHPNYQPVVFMDSTTGFKFLSGSTKGSSETVEWEDGNTYPLLRVEV TSDSHPFYTGRQKFTQADGRVDRFNKKYGL |
|
PDB | 7p7u Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics. |
Chain | 3 |
Resolution | 3.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
3 |
M1 K2 H6 |
M1 K2 H6 |
|
|
|
|