Structure of PDB 7o75 Chain 3

Receptor sequence

>7o753 (length=131) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

NKDMCPICKTDRYLSPDVKFLVNPECYHRICESCVDRIFSLGPAQCPYKG
CDKILRKNKFKTQIFDDVEVEKEVDIRKRVFNVFNKTIDDFNGDLVEYNK
YLEEVEDIIYKLDHGIDVAKTEEKLRTYEEL

3D structure

PDB

7o75 Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	3	C13 C16 C39 C42	C5 C8 C31 C34
BS02	ZN	3	C34 H36 C54 C59	C26 H28 C46 C51

Gene Ontology

	Molecular Function
GO:0000993	RNA polymerase II complex binding
GO:0008270	zinc ion binding
GO:0046872	metal ion binding
GO:0061575	cyclin-dependent protein serine/threonine kinase activator activity

	Biological Process
GO:0006281	DNA repair
GO:0006289	nucleotide-excision repair
GO:0006357	regulation of transcription by RNA polymerase II
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity

	Cellular Component
GO:0005634	nucleus
GO:0005675	transcription factor TFIIH holo complex
GO:0070985	transcription factor TFIIK complex

External links

PDB	RCSB:7o75, PDBe:7o75, PDBj:7o75
PDBsum	7o75
PubMed	34133942
UniProt	Q03290\|TFB3_YEAST RNA polymerase II transcription factor B subunit 3 (Gene Name=TFB3)