Structure of PDB 7o4k Chain 3

Receptor sequence
>7o4k3 (length=130) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
KDMCPICKTDRYLSPDVKFLVNPECYHRICESCVDRIFSLGPAQCPYKGC
DKILRKNKFKTQIFDDVEVEKEVDIRKRVFNVFNKTIDDFNGDLVEYNKY
LEEVEDIIYKLDHGIDVAKTEEKLRTYEEL
3D structure
PDB7o4k Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
Chain3
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN 3 C13 C16 C42 C4 C7 C33
BS02 ZN 3 C34 H36 C54 C59 C25 H27 C45 C50
Gene Ontology
Molecular Function
GO:0000993 RNA polymerase II complex binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
GO:0061575 cyclin-dependent protein serine/threonine kinase activator activity
Biological Process
GO:0006281 DNA repair
GO:0006289 nucleotide-excision repair
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0045737 positive regulation of cyclin-dependent protein serine/threonine kinase activity
Cellular Component
GO:0005634 nucleus
GO:0005675 transcription factor TFIIH holo complex
GO:0070985 transcription factor TFIIK complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o4k, PDBe:7o4k, PDBj:7o4k
PDBsum7o4k
PubMed34133942
UniProtQ03290|TFB3_YEAST RNA polymerase II transcription factor B subunit 3 (Gene Name=TFB3)

[Back to BioLiP]