Structure of PDB 7nvx Chain 3

Receptor sequence
>7nvx3 (length=149) Species: 9606 (Homo sapiens) [Search protein sequence]
MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECG
TPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLE
EVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQKNKLKLTREQEELEE
3D structure
PDB7nvx Structures of mammalian RNA polymerase II pre-initiation complexes.
Chain3
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN 3 C6 C34 C6 C34
BS02 ZN 3 H28 C49 H28 C49
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
GO:0061575 cyclin-dependent protein serine/threonine kinase activator activity
Biological Process
GO:0000082 G1/S transition of mitotic cell cycle
GO:0006281 DNA repair
GO:0006289 nucleotide-excision repair
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0007512 adult heart development
GO:0021591 ventricular system development
GO:0043066 negative regulation of apoptotic process
GO:0045737 positive regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0048661 positive regulation of smooth muscle cell proliferation
GO:0051592 response to calcium ion
GO:2000045 regulation of G1/S transition of mitotic cell cycle
Cellular Component
GO:0000307 cyclin-dependent protein kinase holoenzyme complex
GO:0000439 transcription factor TFIIH core complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005675 transcription factor TFIIH holo complex
GO:0070516 CAK-ERCC2 complex
GO:0070985 transcription factor TFIIK complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nvx, PDBe:7nvx, PDBj:7nvx
PDBsum7nvx
PubMed33902107
UniProtP51948|MAT1_HUMAN CDK-activating kinase assembly factor MAT1 (Gene Name=MNAT1)

[Back to BioLiP]