Structure of PDB 7nvw Chain 3 |
>7nvw3 (length=149) Species: 9606 (Homo sapiens) [Search protein sequence] |
MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECG TPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLE EVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQKNKLKLTREQEELEE |
|
PDB | 7nvw Structures of mammalian RNA polymerase II pre-initiation complexes. |
Chain | 3 |
Resolution | 4.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
3 |
C6 C34 |
C6 C34 |
|
BS02 |
ZN |
3 |
H28 C49 |
H28 C49 |
|
|
|
|