Structure of PDB 7asn Chain 3

Receptor sequence
>7asn3 (length=64) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
PKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVS
KSDMKRVKQLLAYK
3D structure
PDB7asn Staphylococcus aureus 50S after 30 minutes incubation a 37C
Chain3
Resolution2.73 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3 P2 K3 M4 K5 T6 R8 R13 K15 T17 A18 S19 K23 R24 F28 T29 H31 F33 N35 K39 Q40 R42 R45 K46 K52 S53 D54 R57 Q60 Y64 P1 K2 M3 K4 T5 R7 R12 K14 T16 A17 S18 K22 R23 F27 T28 H30 F32 N34 K38 Q39 R41 R44 K45 K51 S52 D53 R56 Q59 Y63
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7asn, PDBe:7asn, PDBj:7asn
PDBsum7asn
PubMed
UniProtQ2FXQ0|RL35_STAA8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]