Structure of PDB 6wm2 Chain 3

Receptor sequence
>6wm23 (length=150) Species: 9606 (Homo sapiens) [Search protein sequence]
SGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKS
IIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLA
AGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
3D structure
PDB6wm2 Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.
Chain3
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 WSS 3 E9 Y10 E4 Y5
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0015078 proton transmembrane transporter activity
GO:0031625 ubiquitin protein ligase binding
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
GO:0046961 proton-transporting ATPase activity, rotational mechanism
Biological Process
GO:0007035 vacuolar acidification
GO:0007042 lysosomal lumen acidification
GO:0015986 proton motive force-driven ATP synthesis
GO:0016241 regulation of macroautophagy
GO:0030177 positive regulation of Wnt signaling pathway
GO:0048388 endosomal lumen acidification
GO:0051452 intracellular pH reduction
GO:0061795 Golgi lumen acidification
GO:0097401 synaptic vesicle lumen acidification
GO:1902600 proton transmembrane transport
Cellular Component
GO:0000139 Golgi membrane
GO:0000220 vacuolar proton-transporting V-type ATPase, V0 domain
GO:0005765 lysosomal membrane
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0030665 clathrin-coated vesicle membrane
GO:0030670 phagocytic vesicle membrane
GO:0030672 synaptic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0033176 proton-transporting V-type ATPase complex
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain
GO:0033179 proton-transporting V-type ATPase, V0 domain
GO:0035577 azurophil granule membrane
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:0070821 tertiary granule membrane
GO:0101003 ficolin-1-rich granule membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6wm2, PDBe:6wm2, PDBj:6wm2
PDBsum6wm2
PubMed33065002
UniProtP27449|VATL_HUMAN V-type proton ATPase 16 kDa proteolipid subunit c (Gene Name=ATP6V0C)

[Back to BioLiP]