Structure of PDB 6w6p Chain 3

Receptor sequence
>6w6p3 (length=49) Species: 474186 (Enterococcus faecalis OG1RF) [Search protein sequence]
MRVNITLECTSCKERNYLTNKNKRNNPDRLEKQKYCPRERKVTLHRETK
3D structure
PDB6w6p Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.
Chain3
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3 R2 R15 Y17 L18 N22 N25 N26 L30 K32 K34 Y35 R40 R2 R15 Y17 L18 N22 N25 N26 L30 K32 K34 Y35 R40
BS02 ZN 3 C9 C12 E39 C9 C12 E39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6w6p, PDBe:6w6p, PDBj:6w6p
PDBsum6w6p
PubMed33004869
UniProtA0A1B4XR98

[Back to BioLiP]