Structure of PDB 6vbv Chain 3

Receptor sequence
>6vbv3 (length=167) Species: 9913 (Bos taurus) [Search protein sequence]
EVHVLCLGLDNSGKTTIINKLKPSNAQSQDIVPTIGFSIQKFKSSSLSFT
VFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDKLRMVVAKEELRTLLNHP
DIKHRRIPILFFANKMDLRDALTSVKVSQLLCLEDIKDKPWHICASDAIK
GEGLQEGVDWLQDQIQS
3D structure
PDB6vbv Structure and activation mechanism of the BBSome membrane protein trafficking complex.
Chain3
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GTP 3 D26 N27 S28 G29 K30 T31 T32 N130 K131 D133 D163 A164 D10 N11 S12 G13 K14 T15 T16 N114 K115 D117 D147 A148
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005525 GTP binding
GO:0005543 phospholipid binding
GO:0062063 BBSome binding
Biological Process
GO:0006612 protein targeting to membrane
GO:0006886 intracellular protein transport
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0030030 cell projection organization
GO:0051258 protein polymerization
GO:0060271 cilium assembly
GO:0061512 protein localization to cilium
Cellular Component
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005879 axonemal microtubule
GO:0005886 plasma membrane
GO:0005930 axoneme
GO:0030117 membrane coat
GO:0042995 cell projection
GO:0060170 ciliary membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6vbv, PDBe:6vbv, PDBj:6vbv
PDBsum6vbv
PubMed31939736
UniProtQ0IIM2|ARL6_BOVIN ADP-ribosylation factor-like protein 6 (Gene Name=ARL6)

[Back to BioLiP]