Structure of PDB 6lsr Chain 3

Receptor sequence

>6lsr3 (length=255) Species: 9606 (Homo sapiens)

WKAVIQVRQKTLHKKTFYYLEQLILKYGMHQNTLRIKEIHDGLDFYYSSK
QHAQKMVEFLQCTVPCRYKASQRLISQDIHSNTYNYKSTFSVEIVPICKD
NVVCLSPKLAQSLGNMNQICVCIRVTSAIHLIDPNTLQVADIDGSTFWSH
PFNSLCHPKQLEEFIVMECSIVQIKRAAGAGMISKKHTLGEVWVQKTSEM
NTDKQYFCRTHLGHLLNPGDLVLGFDLANCNLNDEHVNKMNSDRVPDVVL
IKKSY

3D structure

• PDB: 6lsr Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
• Chain: 3
• Resolution: 3.13 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	3	Q158 R160 K167 Y171 Q174 Q203 S223 Q224 R225 I231 H232 S233 N234 Y236 T241 S243 Q263 G266 N267 A331 G332 A333 K339 H367 L368 N386 K406 Y408	Q6 R8 K15 Y19 Q22 Q51 S71 Q72 R73 I79 H80 S81 N82 Y84 T89 S91 Q111 G114 N115 A178 G179 A180 K186 H214 L215 N233 K253 Y255

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0030674 protein-macromolecule adaptor activity
• GO:0043023 ribosomal large subunit binding

Biological Process

• GO:0000055 ribosomal large subunit export from nucleus
• GO:0015031 protein transport
• GO:0032092 positive regulation of protein binding
• GO:1902680 positive regulation of RNA biosynthetic process
• GO:1904751 positive regulation of protein localization to nucleolus

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0016020 membrane

External links

• PDB: RCSB:6lsr, PDBe:6lsr, PDBj:6lsr
• PDBsum: 6lsr
• PubMed: 32669547
• UniProt: Q96D46|NMD3_HUMAN 60S ribosomal export protein NMD3 (Gene Name=NMD3)