Structure of PDB 6kaf Chain 3

Receptor sequence

>6kaf3 (length=219) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

IEFYGPNRAKWLGPYSENATPAYLTGEFPGDYGWDTAGLSADPETFKRYR
ELELIHARWAMLGALGCITPELLAKSGTQFGEAVWFKAGAQIFSEGGLDY
LGNPSLVHAQNIVATLAVQVILMGLVEGYRVNGGPAGEGLDPLYPGESFD
PLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIQNLDDH
LSNPTVNNAFAFATKFTPS

3D structure

PDB

6kaf Structure of a C2S2M2N2-type PSII-LHCII supercomplex from the green algaChlamydomonas reinhardtii.

Chain

Resolution

3.73 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	3	A242 F245 T246	A213 F216 T217
BS02	CLA	3	G59 D60 Y61 G62 W63 D64 F75 Y78 E82 R202 M205	G30 D31 Y32 G33 W34 D35 F46 Y49 E53 R173 M176
BS03	CLA	3	L91 L94 G95 T98 P99 L127 Y129 L130	L62 L65 G66 T69 P70 L98 Y100 L101
BS04	CLA	3	R87 M90 Y173 P174 G175 D179 G182 L183 F190 L193 E197	R58 M61 Y144 P145 G146 D150 G153 L154 F161 L164 E168
BS05	CLA	3	F32 K196 K199	F3 K167 K170
BS06	CLA	3	K196 N200	K167 N171
BS07	CLA	3	F206 S207 F209 G210 V213 Q214 H229 N237	F177 S178 F180 G181 V184 Q185 H200 N208
BS08	CLA	3	H229 P233 N237	H200 P204 N208
BS09	CHL	3	W40 L41	W11 L12
BS10	CHL	3	L135 V136 A138 Q139	L106 V107 A109 Q110
BS11	CHL	3	Q148 L151 M152 V155	Q119 L122 M123 V126
BS12	CHL	3	F115 K116 G118 A119 F122 Q148 F212 I216	F86 K87 G89 A90 F93 Q119 F183 I187
BS13	CHL	3	R87 W88 L91 V155 R159 G162 P164 A165 G166 P174 F178	R58 W59 L62 V126 R130 G133 P135 A136 G137 P145 F149
BS14	CHL	3	I84 H85 W88 M152 G153 E156 R159	I55 H56 W59 M123 G124 E127 R130

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6kaf, PDBe:6kaf, PDBj:6kaf
PDBsum	6kaf
PubMed	31570614
UniProt	Q93WL4

[Back to BioLiP]