Structure of PDB 6ha8 Chain 3

Receptor sequence

>6ha83 (length=64) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

PKMKTHRGSAKRFKKTGSGKLKRSHAYTSHLFANKSQKQKRKLRKSAVVS
AGDFKRIKQMLANI

3D structure

• PDB: 6ha8 Structural basis for antibiotic resistance mediated by theBacillus subtilisABCF ATPase VmlR.
• Chain: 3
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	3	P2 K3 M4 K5 T6 H7 R8 K12 R13 K15 G18 S19 K21 K23 R24 H26 A27 Y28 T29 S30 H31 L32 F33 A34 N35 Q38 K39 Q40 K41 K43 R45 K46 D54 R57 Q60 A63 N64	P1 K2 M3 K4 T5 H6 R7 K11 R12 K14 G17 S18 K20 K22 R23 H25 A26 Y27 T28 S29 H30 L31 F32 A33 N34 Q37 K38 Q39 K40 K42 R44 K45 D53 R56 Q59 A62 N63

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ha8, PDBe:6ha8, PDBj:6ha8
• PDBsum: 6ha8
• PubMed: 30126986
• UniProt: P55874|RL35_BACSU Large ribosomal subunit protein bL35 (Gene Name=rpmI)