Structure of PDB 6gym Chain 3

Receptor sequence

>6gym3 (length=138) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

ENKDMCPICKTDRYLSPDVKFLVNPECYHRICESCVDRIFSLGPAQCPYK
GCDKILRKNKFKTQIFDDVEVEKEVDIRKRVFNVFNKTIDDFNGDLVEYN
KYLEEVEDIIYKLDHGIDVAKTEEKLRTYEELNKQLIM

3D structure

PDB

6gym Promoter Distortion and Opening in the RNA Polymerase II Cleft.

Chain

Resolution

6.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	3	I15 C16	I8 C9
BS02	ZN	3	C34 H36	C27 H29

Gene Ontology

	Molecular Function
GO:0000993	RNA polymerase II complex binding
GO:0008270	zinc ion binding
GO:0046872	metal ion binding
GO:0061575	cyclin-dependent protein serine/threonine kinase activator activity

	Biological Process
GO:0006281	DNA repair
GO:0006289	nucleotide-excision repair
GO:0006357	regulation of transcription by RNA polymerase II
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity

	Cellular Component
GO:0005634	nucleus
GO:0005675	transcription factor TFIIH holo complex
GO:0070985	transcription factor TFIIK complex

External links

PDB	RCSB:6gym, PDBe:6gym, PDBj:6gym
PDBsum	6gym
PubMed	30472190
UniProt	Q03290\|TFB3_YEAST RNA polymerase II transcription factor B subunit 3 (Gene Name=TFB3)