Structure of PDB 6fti Chain 3 |
>6fti3 (length=120) Species: 9615 (Canis lupus familiaris) [Search protein sequence] |
AMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRV NGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVL LSFFMARVFMRMKLPGYLMG |
|
PDB | 6fti Structural basis for coupling protein transport and N-glycosylation at the mammalian endoplasmic reticulum. |
Chain | 3 |
Resolution | 4.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
3 |
F118 R136 |
F89 R107 |
|
|
|
|