Structure of PDB 6fos Chain 3

Receptor sequence
>6fos3 (length=150) Species: 280699 (Cyanidioschyzon merolae strain 10D) [Search protein sequence]
EGCFDPLGFTEVFSLEWLREAEIKHCRVAMLAVLGVIAQEFGTFDFYNAK
SKLQLSPDLHNQFVQNGALQQILLFVCAWEFIVGLPALIESVNGNREPGY
FGFDPLKLGGTVGSAQWKRMQAGELRNGRLAMIAFGGFFHQQLLTKQGII
3D structure
PDB6fos Structure and function of photosystem I in Cyanidioschyzon merolae.
Chain3
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA 3 M180 Q181 M120 Q121
BS02 CLA 3 C86 A89 M90 E184 N187 C26 A29 M30 E124 N127
BS03 CLA 3 I193 G197 H200 Q201 I133 G137 H140 Q141
BS04 CLA 3 T70 E71 R189 T10 E11 R129
BS05 CLA 3 L94 I97 A98 Q99 L34 I37 A38 Q39
BS06 CLA 3 E61 R179 E1 R119
BS07 CLA 3 L115 N126 L55 N66
BS08 CLA 3 R87 F141 R27 F81
BS09 CLA 3 E80 V88 L134 E20 V28 L74
Gene Ontology
Molecular Function
GO:0016168 chlorophyll binding
Biological Process
GO:0009416 response to light stimulus
GO:0009765 photosynthesis, light harvesting
GO:0009768 photosynthesis, light harvesting in photosystem I
GO:0015979 photosynthesis
Cellular Component
GO:0009536 plastid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fos, PDBe:6fos, PDBj:6fos
PDBsum6fos
PubMed29582227
UniProtM1UU36

[Back to BioLiP]