Structure of PDB 5xnm Chain 3

Receptor sequence

>5xnm3 (length=220) Species: 3888 (Pisum sativum) [Search protein sequence]

DLWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAGLSADPEAFAKNRA
LEVIHGRWAMLGALGCITPEVLQKWVRVDFKEPVWFKAGSQIFSEGGLDY
LGNPNLVHAQSILAVLGFQIVLMGLVEGFRINGLPDVGEGNDLYPGGQYF
DPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLD
HLDNPVANNAWVYATKFVPG

3D structure

PDB

5xnm Structure and assembly mechanism of plant C2S2M2-type PSII-LHCII supercomplex

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	3	W233 A236 T237 F239 V240	W211 A214 T215 F217 V218
BS02	CHL	3	W55 T57	W33 T35
BS03	CHL	3	V31 Y33 L34 P36 Y53 W55	V9 Y11 L12 P14 Y31 W33
BS04	CLA	3	G51 D52 Y53 G54 W55 D56 L60 S61 N70 R71 E74 H77 R196 M199 F203	G29 D30 Y31 G32 W33 D34 L38 S39 N48 R49 E52 H55 R174 M177 F181
BS05	CLA	3	L73 H77 F206	L51 H55 F184
BS06	CLA	3	L83 L86 G87 F102 Q113 L120 Y122 L123	L61 L64 G65 F80 Q91 L98 Y100 L101
BS07	CHL	3	N127 L128 V129 H130 A131 S133	N105 L106 V107 H108 A109 S111
BS08	CHL	3	V137 Q141 M145	V115 Q119 M123
BS09	CHL	3	F108 K109 G111 Q141 F206	F86 K87 G89 Q119 F184
BS10	CHL	3	R79 W80 V148 F151 R152 G155 L156 V159 L165 F172	R57 W58 V126 F129 R130 G133 L134 V137 L143 F150
BS11	CHL	3	L73 I76 H77 W80 Q141 M145 G146 E149 R152 I153	L51 I54 H55 W58 Q119 M123 G124 E127 R130 I131
BS12	CLA	3	R79 M82 Y166 P167 G168 F172 F184 L187 K188 E191	R57 M60 Y144 P145 G146 F150 F162 L165 K166 E169
BS13	CLA	3	W25 K190 K193 N194 L197	W3 K168 K171 N172 L175
BS14	CLA	3	K190 N194 L197	K168 N172 L175
BS15	CLA	3	F200 G204 V207 Q208 V211 T212 N219 L220 H223 N230 N231 A232 Y235	F178 G182 V185 Q186 V189 T190 N197 L198 H201 N208 N209 A210 Y213
BS16	CLA	3	H223 L224 P227 W233	H201 L202 P205 W211

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding
GO:0019904	protein domain specific binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009635	response to herbicide
GO:0009644	response to high light intensity
GO:0009737	response to abscisic acid
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0009769	photosynthesis, light harvesting in photosystem II
GO:0010119	regulation of stomatal movement
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009517	PSII associated light-harvesting complex II
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0009941	chloroplast envelope
GO:0010287	plastoglobule
GO:0016020	membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5xnm, PDBe:5xnm, PDBj:5xnm
PDBsum	5xnm
PubMed	28839073
UniProt	Q04918

[Back to BioLiP]