Structure of PDB 5v7q Chain 3

Receptor sequence
>5v7q3 (length=62) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
PKAKTHSGASKRFRRTGTGKIVRQKANRRHLLEHKPSTRTRRLDGRTVVA
ANDTKRVTSLLN
3D structure
PDB5v7q Structural insights into species-specific features of the ribosome from the human pathogen Mycobacterium tuberculosis.
Chain3
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3 P2 K3 A4 K5 H7 S8 K12 R13 R15 T17 G18 K21 R24 K26 A27 N28 R30 H31 L32 L33 H35 S38 R40 R42 R43 R47 N53 K56 N63 P1 K2 A3 K4 H6 S7 K11 R12 R14 T16 G17 K20 R23 K25 A26 N27 R29 H30 L31 L32 H34 S37 R39 R41 R42 R46 N52 K55 N62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5v7q, PDBe:5v7q, PDBj:5v7q
PDBsum5v7q
PubMed28977617
UniProtP9WH91|RL35_MYCTU Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]