Structure of PDB 5umd Chain 3

Receptor sequence

>5umd3 (length=119) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

NVKAYELRTLKKKELLDKLDELKKELSGLRISKALGNSAKNSKIHGVRKN
VARVLTVYNQKRKMELRQLYKNKKFKPYNLRKKLTKNKRLQLSPKQKAAM
TLRQKKKVQNFPQRKYLVV

3D structure

PDB

5umd Mefloquine targets the Plasmodium falciparum 80S ribosome to inhibit protein synthesis.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	3	R69 F77 Y80 R83 K88 L92 L104 R105 K108 K109 Q111 N112 K117	R67 F75 Y78 R81 K86 L90 L102 R103 K106 K107 Q109 N110 K115
BS02	rna	3	N3 K5 A6 Y7 K13 K14 K15 L18 K35 N43 S44 H47 R50 K51 A54 R55 L57 T58 Y60 N61 R64 K65 Y80 K85 T87 K88 R91	N1 K3 A4 Y5 K11 K12 K13 L16 K33 N41 S42 H45 R48 K49 A52 R53 L55 T56 Y58 N59 R62 K63 Y78 K83 T85 K86 R89

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links