Structure of PDB 5nrg Chain 3

Receptor sequence
>5nrg3 (length=65) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
PKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVS
KSDMKRVKQLLAYKK
3D structure
PDB5nrg Structural insights of lincosamides targeting the ribosome of Staphylococcus aureus.
Chain3
Resolution3.442 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3 P2 K3 M4 T6 H7 T17 A18 S19 R26 A27 F28 S30 H31 L32 F33 N35 Q40 S53 D54 R57 Q60 Y64 P1 K2 M3 T5 H6 T16 A17 S18 R25 A26 F27 S29 H30 L31 F32 N34 Q39 S52 D53 R56 Q59 Y63
BS02 MN 3 G9 A10 R13 G8 A9 R12
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5nrg, PDBe:5nrg, PDBj:5nrg
PDBsum5nrg
PubMed28973455
UniProtQ2FXQ0|RL35_STAA8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]