Structure of PDB 5nd9 Chain 3 |
>5nd93 (length=81) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] |
MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDI SSDSHPFYTGRQKFAAADGRVERFNKKFGLK |
|
PDB | 5nd9 Structures and dynamics of hibernating ribosomes from Staphylococcus aureus mediated by intermolecular interactions of HPF. |
Chain | 3 |
Resolution | 3.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
3 |
M1 K2 |
M1 K2 |
|
|
|
|