Structure of PDB 5mlc Chain 3

Receptor sequence
>5mlc3 (length=60) Species: 3562 (Spinacia oleracea) [Search protein sequence]
DVRVKVILECTGCVRKSVNKGSRGVSRYITQKNRHNTPSRLELRKFCPYC
YKHTIHGEIK
3D structure
PDB5mlc Cryo-EM structure of the spinach chloroplast ribosome reveals the location of plastid-specific ribosomal proteins and extensions.
Chain3
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3 R8 K10 K25 S27 G29 V30 R32 Y33 Q36 N38 N41 L46 L48 R49 K50 F51 Y56 K57 H58 R3 K5 K20 S22 G24 V25 R27 Y28 Q31 N33 N36 L41 L43 R44 K45 F46 Y51 K52 H53
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0009507 chloroplast
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mlc, PDBe:5mlc, PDBj:5mlc
PDBsum5mlc
PubMed27986857
UniProtP28805|RK33_SPIOL Large ribosomal subunit protein bL33c (Gene Name=rpl33)

[Back to BioLiP]