Structure of PDB 5jbh Chain 3

Receptor sequence
>5jbh3 (length=123) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence]
MAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKL
VIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVA
IIEPGKARDLVEEIAMKVKELMK
3D structure
PDB5jbh Cryo-EM study of start codon selection during archaeal translation initiation.
Chain3
Resolution5.34 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3 K34 G35 T36 N37 E38 D56 D58 K83 K84 I92 V94 A95 K34 G35 T36 N37 E38 D56 D58 K83 K84 I92 V94 A95
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jbh, PDBe:5jbh, PDBj:5jbh
PDBsum5jbh
PubMed27819266
UniProtP62008|RL7A_PYRAB Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]