Structure of PDB 5imq Chain 3

Receptor sequence

>5imq3 (length=134) Species: 300852 (Thermus thermophilus HB8)

VVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIV
PVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQ
VLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVE

3D structure

• PDB: 5imq Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome
• Chain: 3
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	3	Q11 L12 P13 P21 P22 P25 I52 P73 A74 S75 I78 L84 K86 G87 A88 K90 P91 N116 D119 R125 M126 A128 G129 S130 A131 R132 S133 M134 E137	Q8 L9 P10 P18 P19 P22 I49 P70 A71 S72 I75 L81 K83 G84 A85 K87 P88 N113 D116 R122 M123 A125 G126 S127 A128 R129 S130 M131 E134

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5imq, PDBe:5imq, PDBj:5imq
• PDBsum: 5imq
• PubMed: 27137929
• UniProt: Q5SLP6|RL11_THET8 Large ribosomal subunit protein uL11 (Gene Name=rplK)