Structure of PDB 5h5u Chain 3

Receptor sequence
>5h5u3 (length=45) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
SRYQHTKGQIKDNAIEALLHDPLFRQRVEKNKKGKGSYMRKGKHG
3D structure
PDB5h5u Mechanistic insights into the alternative translation termination by ArfA and RF2
Chain3
Resolution3.01 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3 K8 K12 D13 N14 A18 H21 K7 K11 D12 N13 A17 H20
BS02 rna 3 T7 G9 R26 R28 E30 K34 K36 Y39 R41 K42 K44 H45 T6 G8 R25 R27 E29 K33 K35 Y38 R40 K41 K43 H44
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0019843 rRNA binding
GO:0043023 ribosomal large subunit binding
Biological Process
GO:0006417 regulation of translation
GO:0072344 rescue of stalled ribosome

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5h5u, PDBe:5h5u, PDBj:5h5u
PDBsum5h5u
PubMed27906160
UniProtP36675|ARFA_ECOLI Alternative ribosome-rescue factor A (Gene Name=arfA)

[Back to BioLiP]