Structure of PDB 4wfn Chain 3

Receptor sequence

>4wfn3 (length=59) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539)

THKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEW
ARMKLMLPR

3D structure

• PDB: 4wfn The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
• Chain: 3
• Resolution: 3.54 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	3	H7 K8 R12 T17 T19 K21 M23 K26 S27 R30 H31 Q32 T34 D39 I41 R42 K46 V49 K52 W55 M61 L62 P63	H2 K3 R7 T12 T14 K16 M18 K21 S22 R25 H26 Q27 T29 D34 I36 R37 K41 V44 K47 W50 M56 L57 P58

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wfn, PDBe:4wfn, PDBj:4wfn
• PDBsum: 4wfn
• PubMed: 28689968
• UniProt: Q9RSW6|RL35_DEIRA Large ribosomal subunit protein bL35 (Gene Name=rpmI)