Structure of PDB 4wce Chain 3

Receptor sequence
>4wce3 (length=60) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
PKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVS
KSDMKRVKQL
3D structure
PDB4wce Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
Chain3
Resolution3.526 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3 P2 K3 M4 K5 T6 H7 R8 T17 S25 R26 A27 F28 T29 H31 L32 F33 K41 L44 L49 K52 M55 V58 K59 P1 K2 M3 K4 T5 H6 R7 T16 S24 R25 A26 F27 T28 H30 L31 F32 K40 L43 L48 K51 M54 V57 K58
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wce, PDBe:4wce, PDBj:4wce
PDBsum4wce
PubMed26464510
UniProtQ2FXQ0|RL35_STAA8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]