Structure of PDB 3jbn Chain 3

Receptor sequence
>3jbn3 (length=95) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]
PKKRRNGGRSKHNRGHVNPLRCSNCGRCVPKDKAIKRFNIRNIVDTSAQR
DIKEASVYSTFQLPKLYIKQCYCVSCAIHSRFVRVRSREQRRVRK
3D structure
PDB3jbn Dynamical features of the Plasmodium falciparum ribosome during translation.
Chain3
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3 P2 K3 K4 R5 R6 N7 G8 R10 K12 H13 N14 R15 G16 H17 K32 K34 K37 R38 F39 K70 V75 I79 R82 R85 R87 S88 R89 R92 R93 R95 K96 P1 K2 K3 R4 R5 N6 G7 R9 K11 H12 N13 R14 G15 H16 K31 K33 K36 R37 F38 K69 V74 I78 R81 R84 R86 S87 R88 R91 R92 R94 K95
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jbn, PDBe:3jbn, PDBj:3jbn
PDBsum3jbn
PubMed26432834
UniProtO96258

[Back to BioLiP]