Structure of PDB 2otj Chain 3

Receptor sequence

>2otj3 (length=92) Species: 2238 (Haloarcula marismortui)

MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDG
KFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE

3D structure

• PDB: 2otj The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
• Chain: 3
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	3	M1 Q2 P4 N8 T9 Y10 H13 N15 E16 H17 V25 S27 G28 R29 Q30 T31 M33 K34 W35 I36 R38 Q39 R42 G45 I46 G47 N48 G50 K51 S53 K54 G58 D59 K60 P61 T62 K63 K64 T65 D66 K68 K76 A77 L79 R80 G82 R84 A85 G86 Q91	M1 Q2 P4 N8 T9 Y10 H13 N15 E16 H17 V25 S27 G28 R29 Q30 T31 M33 K34 W35 I36 R38 Q39 R42 G45 I46 G47 N48 G50 K51 S53 K54 G58 D59 K60 P61 T62 K63 K64 T65 D66 K68 K76 A77 L79 R80 G82 R84 A85 G86 Q91	PDBbind-CN: Kd=2nM
BS02	13T	3	I36 R40 P56	I36 R40 P56
BS03	MG	3	G45 G47 D49	G45 G47 D49

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding
• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2otj, PDBe:2otj, PDBj:2otj
• PDBsum: 2otj
• PubMed: 17321546
• UniProt: P32411|RL44E_HALMA Large ribosomal subunit protein eL42 (Gene Name=rpl44e)