Structure of PDB 1nkw Chain 3 |
>1nkw3 (length=63) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] |
PKMKTHKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLA KAEWARMKLMLPR |
|
PDB | 1nkw High resolution structure of the large ribosomal subunit from a mesophilic eubacterium |
Chain | 3 |
Resolution | 3.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
3 |
P2 G28 |
P1 G27 |
|
|
|
|