Structure of PDB 1kc8 Chain 3

Receptor sequence

>1kc83 (length=46) Species: 2238 (Haloarcula marismortui)

GKKSKATKKRLAKLDNQNSRVPAWVMLKTDERNHKRRHWRRNDTDE

3D structure

• PDB: 1kc8 Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
• Chain: 3
• Resolution: 3.01 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	3	G1 K2 K3 K5 A6 K8 K9 R10 L11 K13 N16 Q17 S19 P22 W24 V25 L27 K28 T29 D30 R35 H37 R40 H41 W42 R43 N45 T47	G1 K2 K3 K5 A6 K8 K9 R10 L11 K13 N16 Q17 S19 P22 W24 V25 L27 K28 T29 D30 R32 H34 R37 H38 W39 R40 N42 T44

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1kc8, PDBe:1kc8, PDBj:1kc8
• PDBsum: 1kc8
• PubMed: 12860128
• UniProt: P22452|RL39_HALMA Large ribosomal subunit protein eL39 (Gene Name=rpl39e)