Structure of PDB 8t8c Chain 2y

Receptor sequence

>8t8c2y (length=96) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

MNITSKQMEITPAIRQHVADRLAKLEKWQTHLINPHIILSKEPQGFVADA
TINTPNGVLVASGKHEDMYTAINELINKLERQLNKLQHKGEARRAA

3D structure

PDB

8t8c Practical Synthesis of N -Formylmethionylated Peptidyl-tRNA Mimics.

Chain

Resolution

2.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2y	N4 I5 T6 S7 K8 R17 K26 K29 W30 Q31 H33 I35 N36 I40 P45 Q46 T53 P57 V62 A63 S64 T72 K80 R83 Q84 K87 H90 K91 E93 A94 R95 R96	N2 I3 T4 S5 K6 R15 K24 K27 W28 Q29 H31 I33 N34 I38 P43 Q44 T51 P55 V60 A61 S62 T70 K78 R81 Q82 K85 H88 K89 E91 A92 R93 R94

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0043024	ribosomal small subunit binding

	Biological Process
GO:0006417	regulation of translation
GO:0009409	response to cold
GO:0022611	dormancy process
GO:0044238	primary metabolic process
GO:0045900	negative regulation of translational elongation
GO:0045947	negative regulation of translational initiation

	Cellular Component
GO:0005829	cytosol
GO:0022627	cytosolic small ribosomal subunit

External links

PDB	RCSB:8t8c, PDBe:8t8c, PDBj:8t8c
PDBsum	8t8c
PubMed	37433044
UniProt	P0AD49\|YFIA_ECOLI Ribosome-associated inhibitor A (Gene Name=raiA)