Structure of PDB 6l4u Chain 2u

Receptor sequence
>6l4u2u (length=89) [Search protein sequence]
DMTWEGEYPPSKVLGPIMSKMPSGLLGLISIACAAVCAYSIAQSGVLQQQ
PGAYENGSWVKWYYVLGSFGGPLAWGTHVASWIQRKNGM
3D structure
PDB6l4u Structure of photosystem I-light-harvesting supercomplex from a red-lineage diatom
Chain2u
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA 2u N88 G89 W91 V92 W94 N56 G57 W59 V60 W62
BS02 CLA 2u V45 L46 M50 W107 G108 V13 L14 M18 W75 G76
BS03 CLA 2u W107 H110 W114 W75 H78 W82
BS04 A86 2u I73 V97 I41 V65
BS05 A86 2u G56 S62 I63 S100 G103 P104 A106 W107 H110 R117 G24 S30 I31 S68 G71 P72 A74 W75 H78 R85
External links