Structure of PDB 8vty Chain 2t

Receptor sequence

>8vty2t (length=98) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

PKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKI
MRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGG

3D structure

PDB

8vty Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.

Chain

Resolution

2.6 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2t	N9 L10 S11 A12 K14 R15 H16 R17 Q18 K21 R22 R23 N26 A28 K29 S31 K34 T35 L36 K38 K39 E51 K54 R57 E60 S61 D64 K68 S70 H73 N75 A78 R79 K81 S82 R83 M85 R89 G101 G102 G103	N4 L5 S6 A7 K9 R10 H11 R12 Q13 K16 R17 R18 N21 A23 K24 S26 K29 T30 L31 K33 K34 E46 K49 R52 E55 S56 D59 K63 S65 H68 N70 A73 R74 K76 S77 R78 M80 R84 G96 G97 G98
BS02	MG	2t	A67 L72	A62 L67

External links

PDB	RCSB:8vty, PDBe:8vty, PDBj:8vty
PDBsum	8vty
PubMed	39039256
UniProt	P80380\|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)