Structure of PDB 8fc5 Chain 2t

Receptor sequence

>8fc52t (length=98) Species: 300852 (Thermus thermophilus HB8)

PKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKI
MRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGG

3D structure

• PDB: 8fc5 Structural insights into the mechanism of overcoming Erm-mediated resistance by macrolides acting together with hygromycin-A.
• Chain: 2t
• Resolution: 2.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2t	N9 L10 S11 A12 K14 R15 H16 R17 Q18 S19 K21 R22 R23 N26 A28 K29 S31 K34 T35 K39 E51 K54 I55 E60 S61 D64 K68 S70 H73 K74 N75 A78 R79 K81 S82 R83 M85 R89 G101 G102 G103	N4 L5 S6 A7 K9 R10 H11 R12 Q13 S14 K16 R17 R18 N21 A23 K24 S26 K29 T30 K34 E46 K49 I50 E55 S56 D59 K63 S65 H68 K69 N70 A73 R74 K76 S77 R78 M80 R84 G96 G97 G98
BS02	MG	2t	A67 L72	A62 L67

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fc5, PDBe:8fc5, PDBj:8fc5
• PDBsum: 8fc5
• PubMed: 37452045
• UniProt: P80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)