Structure of PDB 5v8i Chain 2t

Receptor sequence

>5v8i2t (length=98) Species: 262724 (Thermus thermophilus HB27)

PKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKI
MRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGG

3D structure

• PDB: 5v8i Structural robustness of the ribosome inferred from X-ray crystal structures of the 30S ribosomal subunit and the 70S ribosome lacking ribosomal protein uS17
• Chain: 2t
• Resolution: 3.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2t	N9 L10 S11 K14 R15 H16 R17 S19 R22 R23 N26 A28 K29 S31 K34 T35 K39 K54 R57 E60 S61 D64 K68 S70 H73 N75 A78 R79 K81 S82 R83 M85 R89 G101 G102 G103	N4 L5 S6 K9 R10 H11 R12 S14 R17 R18 N21 A23 K24 S26 K29 T30 K34 K49 R52 E55 S56 D59 K63 S65 H68 N70 A73 R74 K76 S77 R78 M80 R84 G96 G97 G98
BS02	MG	2t	A67 G69	A62 G64

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5v8i, PDBe:5v8i, PDBj:5v8i
• PDBsum: 5v8i
• UniProt: P62661|RS20_THET2 Small ribosomal subunit protein bS20 (Gene Name=rpsT)