Structure of PDB 8ud6 Chain 2r

Receptor sequence
>8ud62r (length=68) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
AKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKT
IKRARILGLLPFTEKLVR
3D structure
PDB8ud6 An antibiotic preorganized for ribosomal binding overcomes antimicrobial resistance
Chain2r
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2r K49 I50 K61 R64 K68 K71 R72 R74 I75 F81 K30 I31 K42 R45 K49 K52 R53 R55 I56 F62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ud6, PDBe:8ud6, PDBj:8ud6
PDBsum8ud6
PubMed38359125
UniProtQ5SLQ0|RS18_THET8 Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]