Structure of PDB 6nd6 Chain 2r

Receptor sequence

>6nd62r (length=68) Species: 300852 (Thermus thermophilus HB8)

AKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKT
IKRARILGLLPFTEKLVR

3D structure

• PDB: 6nd6 High-resolution crystal structures of ribosome-bound chloramphenicol and erythromycin provide the ultimate basis for their competition.
• Chain: 2r
• Resolution: 2.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2r	K49 I50 K61 Q63 R64 K68 K71 R72 R74 I75 F81	K30 I31 K42 Q44 R45 K49 K52 R53 R55 I56 F62

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6nd6, PDBe:6nd6, PDBj:6nd6
• PDBsum: 6nd6
• PubMed: 30733327
• UniProt: Q5SLQ0|RS18_THET8 Small ribosomal subunit protein bS18 (Gene Name=rpsR)