Structure of PDB 8vtv Chain 2q

Receptor sequence

>8vtv2q (length=99) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKY
KLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK

3D structure

PDB

8vtv Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.

Chain

Resolution

2.55 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	2q	P2 K3 K14 M15 Q16 K17 T18 R25 L31 Y32 K34 R38 S39 K40 K41 Y42 E61 S62 R63 P64 I65 S66 K67 R68 K69 R70 R72 K87 R91 N94 Y95 L98 S99 K100	P1 K2 K13 M14 Q15 K16 T17 R24 L30 Y31 K33 R37 S38 K39 K40 Y41 E60 S61 R62 P63 I64 S65 K66 R67 K68 R69 R71 K86 R90 N93 Y94 L97 S98 K99
BS02	MG	2q	K50 Y51 D55	K49 Y50 D54
BS03	MG	2q	D13 E49	D12 E48

External links

PDB	RCSB:8vtv, PDBe:8vtv, PDBj:8vtv
PDBsum	8vtv
PubMed	39039256
UniProt	P0DOY7\|RS17_THET8 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)