Structure of PDB 8t8c Chain 2q

Receptor sequence

>8t8c2q (length=99) Species: 300852 (Thermus thermophilus HB8)

PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKY
KLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK

3D structure

• PDB: 8t8c Practical Synthesis of N -Formylmethionylated Peptidyl-tRNA Mimics.
• Chain: 2q
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2q	P2 K3 K14 M15 Q16 K17 T18 R25 L31 Y32 K34 K37 R38 S39 K40 K41 Y42 E61 S62 R63 P64 I65 S66 K67 R68 K69 R70 R72 K87 R91 R92 N94 Y95 S97 L98 K100	P1 K2 K13 M14 Q15 K16 T17 R24 L30 Y31 K33 K36 R37 S38 K39 K40 Y41 E60 S61 R62 P63 I64 S65 K66 R67 K68 R69 R71 K86 R90 R91 N93 Y94 S96 L97 K99

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8t8c, PDBe:8t8c, PDBj:8t8c
• PDBsum: 8t8c
• PubMed: 37433044
• UniProt: P0DOY7|RS17_THET8 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)