Structure of PDB 8cvl Chain 2q

Receptor sequence

>8cvl2q (length=99) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKY
KLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK

3D structure

PDB

8cvl Insights into the ribosome function from the structures of non-arrested ribosome-nascent chain complexes.

Chain

Resolution

2.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2q	P2 K4 S12 K14 M15 Q16 K17 T18 R25 L31 Y32 K34 K37 R38 S39 K40 K41 Y42 E61 S62 R63 P64 S66 K67 R68 K69 R70 R72 K87 R91 R92 N94 Y95 L98 K100	P1 K3 S11 K13 M14 Q15 K16 T17 R24 L30 Y31 K33 K36 R37 S38 K39 K40 Y41 E60 S61 R62 P63 S65 K66 R67 K68 R69 R71 K86 R90 R91 N93 Y94 L97 K99
BS02	MG	2q	D13 E49	D12 E48

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8cvl, PDBe:8cvl, PDBj:8cvl
PDBsum	8cvl
PubMed	36316410
UniProt	P0DOY7\|RS17_THET8 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)