Structure of PDB 9b00 Chain 2p

Receptor sequence

>9b002p (length=82) Species: 300852 (Thermus thermophilus HB8)

MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQ

3D structure

• PDB: 9b00 Berberine analog of chloramphenicol exhibits a distinct mode of action and unveils ribosome plasticity.
• Chain: 2p
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2p	M1 K3 R5 L6 R8 F9 G10 K12 H13 H16 R18 D23 R25 R26 K27 R28 G30 K31 Y32 I33 Y38 P41 R42 K43 T44 W59 V62 G63 T67 D68 T69 R72 R75 F80 R81 Q82	M1 K3 R5 L6 R8 F9 G10 K12 H13 H16 R18 D23 R25 R26 K27 R28 G30 K31 Y32 I33 Y38 P41 R42 K43 T44 W59 V62 G63 T67 D68 T69 R72 R75 F80 R81 Q82

External links

• PDB: RCSB:9b00, PDBe:9b00, PDBj:9b00
• PDBsum: 9b00
• PubMed: 39019034
• UniProt: Q5SJH3|RS16_THET8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)