Structure of PDB 8cvj Chain 2p

Receptor sequence

>8cvj2p (length=82) Species: 300852 (Thermus thermophilus HB8)

MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQ

3D structure

• PDB: 8cvj Insights into the ribosome function from the structures of non-arrested ribosome-nascent chain complexes.
• Chain: 2p
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2p	M1 K3 R5 L6 G10 K12 H13 H16 R18 R25 K27 R28 G30 K31 I33 Y38 P41 K43 T44 W59 V62 G63 T67 D68 T69 R72 R75 F80 Q82	M1 K3 R5 L6 G10 K12 H13 H16 R18 R25 K27 R28 G30 K31 I33 Y38 P41 K43 T44 W59 V62 G63 T67 D68 T69 R72 R75 F80 Q82

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8cvj, PDBe:8cvj, PDBj:8cvj
• PDBsum: 8cvj
• PubMed: 36316410
• UniProt: Q5SJH3|RS16_THET8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)