Structure of PDB 7jqm Chain 2p

Receptor sequence

>7jqm2p (length=82) Species: 300852 (Thermus thermophilus HB8)

MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQ

3D structure

• PDB: 7jqm Peptide Inhibitors of Bacterial Protein Synthesis with Broad Spectrum and SbmA-Independent Bactericidal Activity against Clinical Pathogens.
• Chain: 2p
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2p	M1 V2 K3 R5 L6 R8 F9 G10 K12 H13 H16 Y17 R18 D23 A24 R25 R26 K27 R28 K31 Y32 I33 Y38 P41 R42 T44 W59 V62 G63 Q65 T67 D68 R72 F80 R81	M1 V2 K3 R5 L6 R8 F9 G10 K12 H13 H16 Y17 R18 D23 A24 R25 R26 K27 R28 K31 Y32 I33 Y38 P41 R42 T44 W59 V62 G63 Q65 T67 D68 R72 F80 R81

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7jqm, PDBe:7jqm, PDBj:7jqm
• PDBsum: 7jqm
• PubMed: 32787108
• UniProt: Q5SJH3|RS16_THET8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)