Structure of PDB 9b00 Chain 2o

Receptor sequence
>9b002o (length=88) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB9b00 Berberine analog of chloramphenicol exhibits a distinct mode of action and unveils ribosome plasticity.
Chain2o
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2o H53 L56 V60 G89 H52 L55 V59 G88
BS02 rna 2o P2 K8 Q9 I12 T22 G23 S24 Q28 L31 R35 L39 H42 H46 K48 D49 H50 H51 S52 R54 G55 M58 G61 Q62 R65 R68 Y69 P1 K7 Q8 I11 T21 G22 S23 Q27 L30 R34 L38 H41 H45 K47 D48 H49 H50 S51 R53 G54 M57 G60 Q61 R64 R67 Y68
External links
PDB RCSB:9b00, PDBe:9b00, PDBj:9b00
PDBsum9b00
PubMed39019034
UniProtQ5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]