Structure of PDB 7y7a Chain 2o

Receptor sequence

>7y7a2o (length=166) Species: 35688 (Porphyridium purpureum) [Search protein sequence]

PFLEAPAKLDGTLVGDVGFDPLGLSATLDVKYLRAAELKHGRIAMLAALG
FVVQEILAPKQSGPFTEPDPFLAIYKVPVEGWYQIIAAISLVELVTFKEN
YDGSAEPGNFGFDPLGLGKDKSVFDKYALSELKNGRLAMIAWTAFAIQQI
VTGKGVIKQLMEFQPL

3D structure

PDB

7y7a In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.

Chain

Resolution

4.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	2o	P37 V53 F55	P1 V17 F19
BS02	CLA	2o	D52 V53 F55 D56 L60 L69 R70 E73 H76 R172 M175 I176	D16 V17 F19 D20 L24 L33 R34 E37 H40 R136 M139 I140
BS03	CLA	2o	L82 A83 G86 V89 F101 W118	L46 A47 G50 V53 F65 W82
BS04	CLA	2o	V113 P114 E116 G117 Q120	V77 P78 E80 G81 Q84
BS05	CLA	2o	L93 K96 S98 F101	L57 K60 S62 F65
BS06	CLA	2o	Y68 A72 H76 E129	Y32 A36 H40 E93
BS07	CLA	2o	L74 G77 R78 M81 N145 F146 F148 Y163 E167	L38 G41 R42 M45 N109 F110 F112 Y127 E131
BS08	CLA	2o	M81 N170	M45 N134
BS09	CLA	2o	I176 A177 T179 A180 I183 Q184 L202	I140 A141 T143 A144 I147 Q148 L166
BS10	CLA	2o	T63 L64	T27 L28
BS11	CLA	2o	L58 G59	L22 G23

Gene Ontology

	Biological Process
GO:0009765	photosynthesis, light harvesting

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7y7a, PDBe:7y7a, PDBj:7y7a
PDBsum	7y7a
PubMed	36922595
UniProt	P93450

[Back to BioLiP]