Structure of PDB 7rq8 Chain 2o

Receptor sequence

>7rq82o (length=88) Species: 300852 (Thermus thermophilus HB8)

PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG

3D structure

• PDB: 7rq8 A synthetic antibiotic class overcoming bacterial multidrug resistance.
• Chain: 2o
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2o	S40 L56 V60 G89	S39 L55 V59 G88
BS02	rna	2o	P2 K8 I12 F18 T22 G23 Q28 L31 R35 L39 H42 H46 K48 D49 H50 H51 S52 H53 R54 G55 M58 M59 G61 Q62 R64 R65 R68 Y69	P1 K7 I11 F17 T21 G22 Q27 L30 R34 L38 H41 H45 K47 D48 H49 H50 S51 H52 R53 G54 M57 M58 G60 Q61 R63 R64 R67 Y68

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7rq8, PDBe:7rq8, PDBj:7rq8
• PDBsum: 7rq8
• PubMed: 34707295
• UniProt: Q5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)