Structure of PDB 6fkr Chain 2n

Receptor sequence

>6fkr2n (length=60) Species: 300852 (Thermus thermophilus HB8)

ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKG
QLPGVRKASW

3D structure

• PDB: 6fkr The Dolphin Proline-Rich Antimicrobial Peptide Tur1A Inhibits Protein Synthesis by Targeting the Bacterial Ribosome.
• Chain: 2n
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2n	A2 R3 K4 A5 E8 K9 R12 K15 F16 K17 V18 R19 Y21 T22 R23 C27 R29 A30 R31 S32 Y34 R35 R41 I42 C43 R45 E46 S60 W61	A1 R2 K3 A4 E7 K8 R11 K14 F15 K16 V17 R18 Y20 T21 R22 C26 R28 A29 R30 S31 Y33 R34 R40 I41 C42 R44 E45 S59 W60
BS02	ZN	2n	C24 C27 C40 C43	C23 C26 C39 C42

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6fkr, PDBe:6fkr, PDBj:6fkr
• PDBsum: 6fkr
• PubMed: 29526712
• UniProt: P0DOY6|RS14Z_THET8 Small ribosomal subunit protein uS14 (Gene Name=rpsZ)